PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005342m
Common NameEUTSA_v10005342mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 213aa    MW: 24293.9 Da    PI: 10.9041
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005342mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind54.84.3e-17195198
        GAGA_bind  1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd......maflqrdkalaernkalverdnkllall 85
                     mdddg+  rn+gyyepa a++k  lglqlms+i +r++k+    re nl ++++++++++r+      m++    +++++      ++dnk++++l
  Thhalv10005342m  1 MDDDGF--RNWGYYEPAaATFKGSLGLQLMSTI-DRNTKPflpgREPNL-MIGSNGSYHPREhessipMNY----SWMNQ------PKDNKFFNML 82
                     99**99..9*******999**************.9**************.************999999999....*****......********** PP

        GAGA_bind 86 lvenslasalpvg 98
                     + + + ++++pv 
  Thhalv10005342m 83 PPNYNNMMHQPVL 95
                     *998888888764 PP

2GAGA_bind82.81.2e-25166212255301
        GAGA_bind 255 iagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      i+grKmSqgafkk+L+kLa+ Gy+++n +DLk+ WA+HGtnkfvtir
  Thhalv10005342m 166 ISGRKMSQGAFKKVLKKLASKGYSFGNSIDLKSPWARHGTNKFVTIR 212
                      89********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.9E-121159IPR010409GAGA-binding transcriptional activator
SMARTSM012263.5E-561212IPR010409GAGA-binding transcriptional activator
PfamPF062179.0E-23166212IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GSLGLQLMST IDRNTKPFLP GREPNLMIGS NGSYHPREHE  60
SSIPMNYSWM NQPKDNKFFN MLPPNYNNMM HQPVLNSSRF KENSIPPPPP PLEDKLNKKR  120
KTKSCNTTTT LKAKKLQKPK LESDTTNNVQ HQQQQQRVKP VKKRVISGRK MSQGAFKKVL  180
KKLASKGYSF GNSIDLKSPW ARHGTNKFVT IR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ3864031e-145FJ386403.1 Thellungiella halophila putative inositol phosphatase gene, partial cds; cyclin-like protein, putative microtubule-associated protein, putative C2H2 zinc finger protein, brassinosteroid receptor-like protein, putative transmembrane transporter, salt overly sensitive 1-like protein, valyl-tRNA synthetase-like protein, putative glutamate decarboxylase, putative peptide transporter, putative F-box protein, putative nitrate transporter, putative NADH dehydrogenase, putative Myb DNA binding proteins, putative C2H2 zinc finger proteins, putative F-box protein, SWI/SNF helicase-like protein, defensin-like proteins, and putative PPR repeat protein genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395828.11e-157hypothetical protein EUTSA_v10005342mg
SwissprotQ9SKD07e-71BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLV4KPA51e-157V4KPA5_EUTSA; Uncharacterized protein
STRINGAT2G01930.12e-68(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.23e-56basic pentacysteine1